PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D08G0879
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 92aa    MW: 10752.2 Da    PI: 8.7411
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D08G0879genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.22.7e-114587446
                 XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1  4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLk 46
                  k+++r  +NR A  rsR+RKk++++ Le k+  Le+e ++L 
  Gh_D08G0879 45 AKKQKRQLRNRDAVVRSRERKKMYVKDLEMKSRYLEGECRRLS 87
                 59************************************99886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.8E-104087No hitNo description
PROSITE profilePS502179.0714486IPR004827Basic-leucine zipper domain
PfamPF001706.9E-104587IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.81E-94689No hitNo description
CDDcd147043.35E-114792No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 92 aa     Download sequence    Send to blast
METLEDKTDE NMFPPLGSDI VGVDGGDLHK QSQTHTDVDK DNPIAKKQKR QLRNRDAVVR  60
SRERKKMYVK DLEMKSRYLE GECRRLSHVL HC
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.21571e-83boll| ovule| root| stem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012447655.11e-41PREDICTED: bZIP transcription factor 60-like
TrEMBLA0A0D2MW255e-49A0A0D2MW25_G
STRINGGLYMA02G19754.12e-22(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM46342848
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G42990.17e-10basic region/leucine zipper motif 60